McDonnell Genome Institute

Washington University

CircRNA

chr18|76955984|76960855|+|ZNF236|ENST00000253159.12

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9961

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

LWEPGPGQPAR

Amino Acids from 5' Exons

VAGVSGNLAPGNQPEKEGRAHQCLECDRAFSSAAVLMHHSKEVHGRERIHGCPVCRKAFKRATHLK,LASLGTWPRATSQRRRAGRTSAWSVTAPSHRRRCSCTTARRCMAGSASTAAPCAGRPSSAPRTS,SWRLWEPGPGQPAREGGPGAPVPGVPRLLIGGGAHAPQQGGAWPGAHPRLPRVQEGLQARHAPQ

Amino Acids from 3' Exons

GSGRSIARFVRKPSTRRVRCRCTRSTRGSGPTSVPTASWASRRRATSCTSGRTAML,GAAVPLHALESLQPEECAAGAHEEAHGGAALQVCLLRHGLHAEEQHEAAHEAGAQLC,ERPFHCTLCEKAFNQKSALQVHMKKHTGERPYKCAYCVMGFTQKSNMKLHMKRAHSYA