McDonnell Genome Institute

Washington University

CircRNA

chr18|74499881|74506011|+|CNDP2|ENST00000324262.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.941

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

DGRPSVSTR

Amino Acids from 5' Exons

VAPQSPLETGLTSCSSFQEPSRSAVWGLVERWRPSLPCLSTMKIRIATL,SPLSLHRQDPVALPSKNLRDLRSGVWLKDGGPHYPVVHRKSGSLH,RPSVSTRDRTDQLLFLPRTFEICGLGSGKMAALTTLFKYIDENQDRYIK

Amino Acids from 3' Exons

LPDGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVERD,SLMARRSRSLLFCSAGWAPTHRRRPCAFTGTWMCSLQPWRTAGTASPSPWWSET,PWLGDPAPSYSARQAGLRPTEEDRVHLRAPGCAACSPGGRLGQRALHPGGAR