McDonnell Genome Institute

Washington University

CircRNA

chr18|70047970|70109717|-|RTTN|ENST00000255674.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

8

Peptide

SLEQLSDVILQEMLGTSLR

Amino Acids from 5' Exons

ICSAHVQACLPRVLPCILPACNSFLFSPKKQKGISRLRAKHIYAVVQQWLHFLMTLRKIRNLNNLVMSF,YVLHMCRLVCHVSCPVYCQLAIPFCSLDRRSKRASPGEQNTFMLSNSGFTSLSGKSEISRTTCNPS,MFCTCAGLSATCPALYTASLQFLSVLLTEEAKGHLQAKSKTHLCCSPTVASLLDDSQENQKSLEQLSDVILQ

Amino Acids from 3' Exons

EMLGTSLRFSNAAGSETAPVSESDGCASFLWPAVPADLTRDGPHCVSGMELTLSSHKASRYLCEVLVRSP,KCSELLYVFQTQLALKLLQCLKVTDAPHFYGLPSLERTLRGMANLTAFPGWSSHSPLTKPLDICVKYLSGLLE,NARNFFTFFKRSWLNCSSVKRMRLISMACRPLSGPYEGWLTSLRFRDGAHTLLSQSLISVSTCQVSL