McDonnell Genome Institute

Washington University

CircRNA

chr18|66551093|66572316|-|CDH19|ENST00000262150.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9818

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LMTISLYLK

Amino Acids from 5' Exons

ESEYLLKWIENCKMSIGSFKPRTLVSQERCLEQQVYLNFQMLMTISLYLKK,SHKNIFNGRTARVLGNHSSQGHDWSARSVVWNNKCINTFRCQAYIR,VIRISSKMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLIKLSDVNDNKPIFKE

Amino Acids from 3' Exons

VYRRYTESEKIIKESKIFVSDVLFPLKSNSWNQKSQRNELLFTAAFYVGNSSPMALSWSNRKLSNKESQAASAISFESEAWLGVEPIFCTRGNEYDSSHRP,YIEGTQNQKRLKKARFLLVTSCFLRVIVGIKRVNAMNCYLLLRFMLGIPLLWPCLGATENSQTKKVKQPVRSHLRVKRGWVWNQFFVPEEMNTTSHHIGQ,IKVHRIRKDYKRKQDFCRPVSSEELESKESTQTVIYCCVLCWEFLSYGLVLEQQKTLKQRKSSSQCDLIESVAGCGTNFLYQRKIRLVITSA