McDonnell Genome Institute

Washington University

CircRNA

chr18|66543970|66554524|-|CDH19|ENST00000262150.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.998

27

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

NISYPGDSK

Amino Acids from 5' Exons

KVDFEHQNHYGIRAKVKNHHVPEQLMKYHTEASTTFIKIQVEDVDEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPI,KWILSTRTTTVLEQKLKTIMFLSSSSTTLRLPPLSLRSRWKMLMSLLFSSFHIMYLKFLKKPHRDHLAWCLPQTQTIGNLLS,SGFAPEPLRYSKSKPSCSAAHEVPHGFHHFHDPGGRCASSFPPSILCISFRNPTGIICRRGVCHRPRQEISYQ

Amino Acids from 3' Exons

EHLSRQQVMLTIPQVVIMLVSSTAYFKASHIFLLNQQQ,NISYPGDSKCRSLKWCSSPLQLTSRPAIFFCTNN,TLVIQVTASDADDPSSGNNARLLYSLLQGQPYFSVEPTT