McDonnell Genome Institute

Washington University

CircRNA

chr18|66508994|66572316|-|CDH19|ENST00000262150.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

IFVSDVLFPLK

Amino Acids from 5' Exons

ITQLSFLIELVLTFKKNLSSTSPSLPTMESRHLQVQTPLPSMSVTVVTVGAHRPASTRSLCFPWDSRQKSSLLFSFALSYL,HSCHFDNWFPSRRTCLLHLHLNCRQWNPVTYKYKHPYHPCLLWQWEHTDLPVPGACAFHGIQDRSHHCYSHLHYDHI,NTAVILTNRTGFNLQEEPVFYISILIADNGIPSLTSTNTLTIHVCDCGDSGSTQTCQYQELVLSMGFKTEVIIAILICIMIIF

Amino Acids from 3' Exons

VYRRYTESEKIIKESKIFVSDVLFPLKSNSWNQKSQRNELLFTAAFYVGNSSPMALSWSNRKLSNKESQAASAISFESEAWLGVEPIFCTRGNEYDSSHRP,YIEGTQNQKRLKKARFLLVTSCFLRVIVGIKRVNAMNCYLLLRFMLGIPLLWPCLGATENSQTKKVKQPVRSHLRVKRGWVWNQFFVPEEMNTTSHHIGQ,IKVHRIRKDYKRKQDFCRPVSSEELESKESTQTVIYCCVLCWEFLSYGLVLEQQKTLKQRKSSSQCDLIESVAGCGTNFLYQRKIRLVITSA