McDonnell Genome Institute

Washington University

CircRNA

chr18|63915501|63919905|+|SERPINB10|ENST00000238508.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9881

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

LVQNLSLLTLWK

Amino Acids from 5' Exons

VSSMDSLATSINQFALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQ,FPQWTLQHQSTSLPWSAKSLNLLRVKISSFLPGASQLPPCIWAPKVPLQPKWP,FLNGLSSNINQPVCPGVEQKASICSGKYLLFFLEHLNFLDHSVFGRQRYHCSPNGP

Amino Acids from 3' Exons

KYLEDMKTYFGAEPQPVNFVEASDQIRKDINSWVERQTE,NIKTKHILVQNLSLLTLWKLLIKSERTSTLGLKDRPR,IFRRHENIFWCRTSACLCGSFSNQKGHQLLGKTDR