McDonnell Genome Institute

Washington University

CircRNA

chr18|63400047|63400703|-|VPS4B|ENST00000238497.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9838

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

TEFLVQMQGK

Amino Acids from 5' Exons

TGEFIPTCQREQALHYLHNFSLWFKKKKSRTNDGVPSANA,LVKNLFQLARENKPSIIFIDEIDSLCGSRSENESEAARRIKTEFLVQMQ,WLRIYSNLPERTSPPLSSLMKLILSVVQEVKMKVKPHVELRRSSCKCK

Amino Acids from 3' Exons

AREHLGGESYYLGRLEQESPTPKLQQKPTTQHFFQYLPLILFLSGVKVK,QENTLEGNPIIWAAWNRKVLLSQSCSNRSQQLNIFFNIFLSCFVARKK,KRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLGESE