McDonnell Genome Institute

Washington University

CircRNA

chr18|62211152|62228598|+|KIAA1468|ENST00000256858.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9379

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

QFILINLIDR

Amino Acids from 5' Exons

IELGALVPLILTLQDIQMMVTGKQMKKWQ,SSWEHYPFFRLCKIFRWQGNRKSG,RAGSISTLDSLDFARYSDDGNRETDEKVA

Amino Acids from 3' Exons

NGLPQKTLCHPSSLLCSASFGSVAPQRLGQWTASRCKFRQGKKHRHPSFNIRSFHYSREFPKFIPQERKRRNATFFSIKKDSSFT,EMDFLKNEHFAIPAVCDSVQPPLDQLPHKDSEDSGQHPDVNSSDKGKNTDIHLSISDEADSTIPKENSPNSFPRREREGMPPSSLSSKKTVHFDKPN,KWTSSKMNTLPSQQFVTLFSLLWISCPTKTLRTVDSIQMIVQTREKTQTSIFQYQMKLIPLFLKRIPQIHSPGEKEKECHLLLYQVKRQFILINLI