McDonnell Genome Institute

Washington University

CircRNA

chr18|58723047|58734381|+|MALT1|ENST00000345724.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.931

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

LCLDMPPK

Amino Acids from 5' Exons

RRTRLPFEIITGSTPSSKLLWWMCTNLTYDSWTSKWFHCWILLNMRCVMLWMSFYSFTREYM,EGQGCPFDRKYELPGAPQAQSSFGGCVRIDLTETAGLQSGFTVGSYIDACCGVFTPFRQGSI,KDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVY

Amino Acids from 3' Exons

KLRYHSNLGCTKSHRQYCVWICH,NDYDDTIPILDALKVTANIVFGYA,MTTMIPFQSWMHKSPPILCLDMP