McDonnell Genome Institute

Washington University

CircRNA

chr18|58709975|58723251|+|MALT1|ENST00000345724.7

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9722

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

GVYGALCGFGTPR

Amino Acids from 5' Exons

VPYVDLEHQGTYWCHVYNDRDSQDSKKVEIII,CLMWIWNTKEPTGVMYIMIETVKIARRKSS,ALCGFGTPRNLLVSCISRQSRQEGRNHH

Amino Acids from 3' Exons

RRTRLPFEIITGSTPSSKLLWWMCTNLTYDSWTSKWFHCWILLNMRCVMLWMSFYSFTREYM,EGQGCPFDRKYELPGAPQAQSSFGGCVRIDLTETAGLQSGFTVGSYIDACCGVFTPFRQGSI,KDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVY