McDonnell Genome Institute

Washington University

CircRNA

chr18|56756582|56816144|+|WDR7|ENST00000254442.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9745

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

12

Peptide

KSMTLLTMTSPLGNLPK

Amino Acids from 5' Exons

GNLPKYSHNSLMVQAIKTNLTDPDIHVLFFDVEALIIQLLTEEASRPNTALISPENLQKASGSSDKGGSFLTGKRAAVLFQQVKETIKENIKEHLLDDEEEDEEIMRQRREESDPEYRSSKSKPLTLLEYNLTMDTAKLFMSCLHAWGLNEVLDEVCLDRLGMLKPHCTVSFGLLSRGGHMSLMLPGYNQPACKLSHGKTEVGRKLPASEGVGKGTYGVSRAVTTQHLLSIISLANTLMSMTNATFIGDHMKKGPT,EIYLNILITPWFKQRQTQTRTYMCYSLMWKRLFNSLKKPLGRILLLFPQRICKKHLAVQTKGALFLENEQQFSSNKKKRSKRTSRNTSLMMKRRMRRGREGKKVILNIGPANQSHPYNIILWTLQSCLCPAFTPGVMKYWMKFAWIALECNPTAPYRLASCQEEAICHCCRVIISLLVNCHMGKQKEGSCQRLREERELTECPVPSPHSISCLSFLWQILVPMQLLLVIIRRVLP,KFTIFSLPDGSSNKDKPNRPGHTCAILCGSVDYSTPDRSLAEYCSYFPREFAKSIWQFRQRGLFFNWKTSSSSLPTSERNDQREHQGTPPRGGGDNEAEKGRKSISVQQIKAIDPIRIFNYGHCKAVYVLPSRLGFESTGSLPGSPWNAETPLHRIVWPLVKRRPYVTDAAGLSACLTVTWENRSRKEAASVGSRKGNLRSVPCRHHTASPVYHFFGKYFNEYDQCNFYWSYEEGSYQ

Amino Acids from 3' Exons

LESHQKPRRLSPRLLMPQGLKQKSRRKSMTLLTMTSPL,WSHIRSRADYHHGSCLRASKSPGGRAPCRHHH,GVTSEAAQTITTAPDASGPEAKVQEEEHDLVDDDITT