McDonnell Genome Institute

Washington University

CircRNA

chr18|56717963|56816144|+|WDR7|ENST00000254442.7

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9352

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

12

Peptide

KSMTLLTMTSPLAR

Amino Acids from 5' Exons

ARVQHCICSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDT,QEYSTASALPVTTQDFVCERKNACWHLVTFFLFKSNGGLLMITWWWGVQMVLCTSGKWIL,KSTALHLLCSQPLSRTSKFAREKMHNVGISSPFSYSSNQMEAFLPGGGVFRWFCVRLANGY

Amino Acids from 3' Exons

LESHQKPRRLSPRLLMPQGLKQKSRRKSMTLLTMTSPL,WSHIRSRADYHHGSCLRASKSPGGRAPCRHHH,GVTSEAAQTITTAPDASGPEAKVQEEEHDLVDDDITT