McDonnell Genome Institute

Washington University

CircRNA

chr18|56614423|56618126|-|TXNL1|ENST00000217515.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9991

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

9

Peptide

FQNVNSVTMDLMPFINK

Amino Acids from 5' Exons

VRALNMKFLSTYPDLWILKRQKEVNQLKLWNQRMILKKMALFHFVMLSFRMLTV,SGPICKNFYQPTPIYGFRGRKKTNSSSGTDRGYRRWHCSTSLCVSECQCN,QGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVT

Amino Acids from 3' Exons

MDLMPFINKAGCECLNESDEHGFDNCLRKDTTFLESDCDEQ,WICLLLTKLVVNVLMKVMSMDLTTVYEKTQPSWNLTVMN,GFNAFYQSWLMSKAWIQLFTKRHNLLGILT