McDonnell Genome Institute

Washington University

CircRNA

chr18|55254496|55351003|-|TCF4|ENST00000354452.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9673

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

35

Peptide

HSLMQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRR

Amino Acids from 5' Exons

QSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLM,KAELKIVKDWMMLFMFSGTMQWAHPQLCLVVMGTCMESLDLLIMEPWVVWAQGMEPAFFQPTDIHS,KPNRSFRKTGCYSCSPEPCSGPIHSYAWWSWGHAWNHWTFSWSHGWSGLRVWNRPSFSQQTFTH

Amino Acids from 3' Exons

QSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAM,RVSLEVTWIWATQEPFRPPNLVPSTISILAIIPEGGLFTVVPW,ESPWRHGYGQPRNPFAHQTWFPVLSVFQSPKEASSQCH