McDonnell Genome Institute

Washington University

CircRNA

chr18|54879368|54888118|+|RAB27B|ENST00000262094.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9167

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

YGFIMHKDRMDLQGK

Amino Acids from 5' Exons

VYNAQGPNGSSGKAFKVHLQLWDTAGQE,FIMHKDRMDLQGKHLKCIFSFGTLRDKS,LCTRTEWIFRESISASSALGHCGTRA

Amino Acids from 3' Exons

ANCKQMLIVKIQIYLATRQTYQIRGKSMNGKLGNWLTNM,PTASKCLLKSRYSINWQQGRPTRSEGSQTASSGTGQIW,QLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKY