McDonnell Genome Institute

Washington University

CircRNA

chr18|5406776|5445244|-|EPB41L3|ENST00000341928.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

QEDAPMIEPLVPEEK

Amino Acids from 5' Exons

ELEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQEDAPMIEPLVPEE,SKKLKMTNIKPTLASKEPSKPQQTLPRMNGRRGFPPPPCDWPPGRRMPPSNHLSLK,ARKNSRPDETSNQHRAEKNLLRNLNRHCRNEMGEEAFHLPRATGRQAGGCPHDRTTCPR

Amino Acids from 3' Exons

KRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK,NAPEDKCCLIKCVNTTCRKTTLGLRIEMLKTR,TLQRTSAVSVTLELARERLLWAYVSRCKPE