McDonnell Genome Institute

Washington University

CircRNA

chr18|5394676|5419931|-|EPB41L3|ENST00000342933.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

DSMSAAEVGTGQYATTK

Amino Acids from 5' Exons

ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGEDPE,RWLRQLKRPKSSTLTCQPKWSIKRQRSHQKMERIDQ,AGSGNRGQRAAPHVSDQSSGPRDRDHTRRWRGLTR

Amino Acids from 3' Exons

HQMKTMKYTRILCLLQRLVLASTPQQKASLRPTSPLLRRRRLRRSGTRKRTNGGRGKKSRPSRPSGTRE,ISEKPNIHEGFYVCCRGWYWPVRHNKRHLSDQLDHHCDSGEEGGGAGRGRGQTEEGGRSHAHLGHPARGK,SVNENHEIYMKDSMSAAEVGTGQYATTKGISQTNLITTVTPEKKAEEERDEEEDKRRKGEEVTPISAIRHEGK