McDonnell Genome Institute

Washington University

CircRNA

chr18|53416123|53499510|+|DCC|ENST00000412726.5

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9957

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

10

Peptide

VPYTPLLSQPVEHPDK

Amino Acids from 5' Exons

WNTLTKWLMTK,GTPQNGP,EHPDKMANDQ

Amino Acids from 3' Exons

QVKDQLPNNHLCCPHLSLSILAARRHQAEPSPQLVFDQLTHSAALLILCYLHQVQNRKSLTHHFCLSQ,SERTNYPTTTYAAPISAAFQRGGTKQNHPHSLCSTNSPTPQLCSFATSTNECNRTESPLHTTFVSA,VSEGPTTQQPPMLPPSQPEHSSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQP