McDonnell Genome Institute

Washington University

CircRNA

chr18|53322046|53499510|+|DCC|ENST00000412726.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9092

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

10

Peptide

VPYTPLLSQPGLEK

Amino Acids from 5' Exons

DWRKEVSTVSRCQPQSMVLDHLPTGILQRLQRMIM,TGERKSVQFPGVSHDSQWYWTTFQLVYCRDSRESR,LEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDLD

Amino Acids from 3' Exons

QVKDQLPNNHLCCPHLSLSILAARRHQAEPSPQLVFDQLTHSAALLILCYLHQVQNRKSLTHHFCLSQ,SERTNYPTTTYAAPISAAFQRGGTKQNHPHSLCSTNSPTPQLCSFATSTNECNRTESPLHTTFVSA,VSEGPTTQQPPMLPPSQPEHSSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQP