McDonnell Genome Institute

Washington University

CircRNA

chr18|49974349|50001411|-|MYO5B|ENST00000285039.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9767

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

17

Peptide

QHSFIGVLDIYGDEKNQSIIVSGESGAGK

Amino Acids from 5' Exons

PQDVYLSNFCRLLGVEHSQMEHWLCHRKLVTTSETYVKTMSLQQVINARNALAKHIYAQLFGWIVEHINKALHTSLKQHSFIGVLDIY,PRMYTATSADCGWSTVRWSTGCVIASWSPPRRPTSRPCPCSRSMRATPWRSTSMPSCSAGLWSTSTRPCTPPSSSTPSSGSWTSM,PGCIPKQLLPTARGGAQSDGALAVSSQAGHHLGDLRQDHVPAAGDQCAQRPGEAHLCPVVRLDCGAHQQGPAHLPQAALLHRGPGHLW

Amino Acids from 3' Exons

REESVHHSQWGVWSREDGISQVCHALFRHRWWLGQNQHRREGAGIQSHHG,DEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSASETNIEEKVLASSPIME,MRRISPSSVGSLEPGRRYQPSMPCAISPPLVARPVKPTSKRRCWHPVPSW