McDonnell Genome Institute

Washington University

CircRNA

chr18|49791469|49802853|-|ACAA2|ENST00000285093.14

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9112

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

8

Peptide

IVGYFVSGCDPSIMGIGVFVVAAKR

Amino Acids from 5' Exons

GVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGI,VLMVLELLSLVKMLLRNITSHHWQELWATLYLDVIPLSWVL,CSWCWSCYHSRCCETLHTTGKNCGLLCIWMSLYHGY

Amino Acids from 3' Exons

VCLLLLSERPLELTEAFKTSLLLTCLNLLPRLPCLLAKSHLKQLTVLWAMSC,CVCSCCANALWSLRRPSERLHCYLVICCQGCLVCWQSLTNSQCDYGQCPA,VFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQ