McDonnell Genome Institute

Washington University

CircRNA

chr18|45900995|45910742|-|EPG5|ENST00000282041.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9398

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

10

Peptide

DATQLVCTDLNLLQQQARLPIDGCIGRR

Amino Acids from 5' Exons

LKKGFVTCGSMRLPSLPLLCTRRSLLCQLFPLLCYVRRTPPSWCAQTICCNSRP,RKGFKLAEAGSPASPCSAPDEASCASYFLCCAIESEGRHPAGVHRPESVATAGQ,KERVLSNLRKHEAPQPPLALHPTKPPVPVISSAVLLSQKDATQLVCTDLNLLQQQA

Amino Acids from 3' Exons

VTHRWLYWKKVFSKSCSYQFVERNEETFDRGGLPPCCKQGPPCSSRGQRAAREPLWHPWLPDFTRTAQGAGE,LPIDGCIGRRFFQSPAHINLLKEMKRRLTEVADFHHAASKALRVPAEGSEGLPESHSGTPGYLTSPELHKELV,YPMVVLEEGFFKVLLISICKKRDVPRWLTSTMLQARPSVFQQRAVKGCQRATLAPLVTLHQNCTRSW