McDonnell Genome Institute

Washington University

CircRNA

chr18|45882273|45930830|-|EPG5|ENST00000282041.9

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9701

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

LLMQNPEHFTNFEK

Amino Acids from 5' Exons

FDLKQWLSATKPPLSDRTRLLESIHLALTAWGLEPDEDILMPFNLFCKHWTYLLLYQFPDQYSDILRLLMQ,SILNNGAPLNLLCLIVPGFWSPFTWHLLPGALNQMRIFCHLIFSVSTGLIFFSTSFLTSTVTFSGCLCK,RSTMVKRHTSSVSYQASGVHSLGTYCLGPTRGYFDAISFLALDLSSSLPVSPVQHSQAAYA

Amino Acids from 3' Exons

TQNILPTLRSVFLLIAQKRFAFLPLLRWLRPEEPMWTKTSKLLFWRYM,PRTFYQLEVSFFYELRRDLPSDYLCSDGSGQKNQCGRRLHKNYCSGDI,PEHFTNFEKCLSSMNSSEEICLLTTFAQMAQARRTNVDEDFIKIIVLEIYE