McDonnell Genome Institute

Washington University

CircRNA

chr18|45855572|45882487|-|EPG5|ENST00000282041.9

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9924

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

AQQFDLK

Amino Acids from 5' Exons

VPSGCPKHGCLPFSSGSYGRSDPFEAWLITSDPQSSA,FRVVARSMAAFLSVQVPMEDQIRLRPGSELHLTPKAQQ,SEWLPEAWLPSFQFRFLWKIRSVGLALNYIPPKLS

Amino Acids from 3' Exons

FDLKQWLSATKPPLSDRTRLLESIHLALTAWGLEPDEDILMPFNLFCKHWTYLLLYQFPDQYSDILRLLMQ,SILNNGAPLNLLCLIVPGFWSPFTWHLLPGALNQMRIFCHLIFSVSTGLIFFSTSFLTSTVTFSGCLCK,RSTMVKRHTSSVSYQASGVHSLGTYCLGPTRGYFDAISFLALDLSSSLPVSPVQHSQAAYA