McDonnell Genome Institute

Washington University

CircRNA

chr18|45736455|45739662|+|SLC14A1|ENST00000321925.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.988

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

16

Peptide

NVHGAHLANPPPGSWLCPIFSSALNSMLSK

Amino Acids from 5' Exons

PNFLKCIEFHAQQMGPPRLHPPFQHGVVNVPFSHRTLQSILSSQTGHTYNYSSKYLLVPQCPG,PIFSSALNSMLSKWDLPVFTLPFNMALSMYLSATGHYNPFFPAKLVIPITTAPNISWSDLSALE,QFSQVHIPCSANGTSPSSPSLSTWRCQCTFQPQDITIHSFQPNWSYLLQLQISPGLTSVPW

Amino Acids from 3' Exons

DSVFQPHLRTSTLDSGVSTALWPALQWEECSWRSPGKPTSWLLAV,TQSFSPIGHLLWTLGFQQLSGLHCNGRNVHGAHLANPPPGSWL,LSLSAPFEDIYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGC