McDonnell Genome Institute

Washington University

CircRNA

chr18|36730645|36742856|+|FHOD3|ENST00000257209.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9236

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

20

Peptide

TLGFILSTLLAIGNFLNGTNK

Amino Acids from 5' Exons

KTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIE,KLLQMEKGKRSLFWIPRGVTPSILVRCCPLQGRLRSPFILMSMPTKKES,NCCRWKKARDHCSGFQEERHQYWSDGAAPSKDDDRHFEFVCLKQRRNR

Amino Acids from 3' Exons

EVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTN,KQNHSWTRKETSWRTIKPWALSCLLSPLGTFMEL,SSRTTPGPEGRNRPVGEQNLGLYPVYSLSHWELSKWN