McDonnell Genome Institute

Washington University

CircRNA

chr18|36122051|36127016|-|SLC39A6|ENST00000269187.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

6

Peptide

KEGAMAR

Amino Acids from 5' Exons

SHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKK,LMQVTTIVIAMKNQQWKKEDHFSVICLLKTKKVPILIPRGRVQLEACISCFLLNMSSHSNNLKIRRK,SCKSPPSPRTSNGNEKRTTFQSSVFSKHRRKCLFFHVEGSNSSRRPVFHVSCTCPHIDQTIREEK

Amino Acids from 3' Exons

EGAMARKLSVILILTFALSVTNPLHELKAAAFPQTTEKISPNWESGINVDLAISTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHERHSDHEHHSEHEHHSDHDHHSHHNHAASGKNKRKALCPDHDSDSSGKDPRNSQGKGAHRPEHASGRRNVKDSVSASEVTSTVYNTVSEGTHFLETIETPRPGKLFPKDVSSSTPPSVTSKSRVSRLAGRKTNESVSEPRKGFMYSRNTNENPQE,KAQWRGSYLSSPLPSLSQIPFMNKQLLSPRPLRKLVRIGNLALMLTWQFPHGNIIYNSFSTAMEKIILCQLKGSENYFKIAIRLKESIYTMTTTITQTTSITQTMSVTQTMSITQSTSITLTMIITLTIIMLLLVKISEKLFAQTMTQIVQVKILETARGKELTDQNMPVVEGMSRTVLVLVKPQLCTTLSLKELTFRQRLQDLENSSPKMAAPLHPVSHQRAGAGWLVGKQMNLVSPEKALCIPETQMKILR,RRNGEEVICNLDPDLCPLCHKSPSTKSSCFPPDHENSELGIWHCLGNFHTAISSTTAFLPLWRKFFVSRVQKITSKYRHRDKNPYTPPRPSLRPRASLRPASLRPASLRARASLPSSLSPSCCFWKAKSSLPRPLRFRRSKQPGERSSPTRTCQWKECQGQCCSDLNCVQHCLRNSLSRDNRDSKTWKTLPQRCKQLHSTQCHIKEPGEPAGWENKICEAPKRLYVFQKHKKSSG