McDonnell Genome Institute

Washington University

CircRNA

chr18|33957325|33958418|-|NOL4|ENST00000261592.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9481

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

13

Peptide

SGFEMSPAHSYSSYDSGK

Amino Acids from 5' Exons

MFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRRMKRSGFEM,CLSGCLMKTWTEWSQSLSSPKKRSRLSLTHAGDNSLSIKSVPENVYVLTSSPAGGKEVVLR,VCQAVCRKLGPNGPNLAAQRKDPGYHLMQATIPVSRACQKTYTYLPQVLQADEKKWFD

Amino Acids from 3' Exons

SPAHSYSSYDSGKNESVDRGAEDLSLNRGDEDEDDHEDHDDSEKVNETDGVEAERLKAFN,LLHIVTPAMTLAKMRVTEELRTSHTGEMRTKMTTRTMTIRRKLMRQTALKPSGKLL,SCTLLQLLWQKECRPRSGPLTKQGRGRRPRGPRFGESDRRRSRAAESF