McDonnell Genome Institute

Washington University

CircRNA

chr18|31870371|31890866|-|TRAPPC8|ENST00000283351.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9154

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

QLDSDLR

Amino Acids from 5' Exons

NQLQWKWLLETLKFYFCLICHCFGSFILKISVERIMKKLNN,TNYSGSGFKPFESSTFVDFVIALEVSSRFQWKGRSTT,PITVEVAFRNPLKVLLLLTDLSLLWKFHPKDFSGKDNEEVKQL

Amino Acids from 3' Exons

DSDLRSALLLEQAAHCFINMKSPMVRKYAFHMILAGHRFSKAGQ,ILIFEVHFFWNRQHIALTKVPWLENMHFIYWQAIDLVKQG,FSSKCTSFGTGSTLLYKHEKSHGKICISYDIGRPSISRA