McDonnell Genome Institute

Washington University

CircRNA

chr18|3126700|3142063|-|MYOM1|ENST00000261606.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

AVSEEAYKR

Amino Acids from 5' Exons

HHHLHPVISPVLKVFVTQWFLDGSNQIRLEGQKLLAIMTIARSLMGYQENGEKPMSRLSVRRHT,TTISTLYHLSKFSLNGSWMEATRDWRGRNYWLLCELSRGHWGTRKMERSQCQGCQGGIQ,PPSPPCDITCLESFRDSMVLGWKQPDKIGGAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYK

Amino Acids from 3' Exons

RVLCLAPRQTSLSLRPPGAMWCSAGSPLASVVMRALCTLWK,GYCAWPPDRPLCHGHPELCGAQLEAPWPAWSGHYVLCGK,GIVPGPPTDLSVTEATRSYVVLSWKPPGQRGHEGIMYFVEK