McDonnell Genome Institute

Washington University

CircRNA

chr18|2775733|2778239|+|SMCHD1|ENST00000320876.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9947

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

KEIAHLAQIEDDR

Amino Acids from 5' Exons

IAHLAQIEDDRAAMVISWHLASDMDCVVTLTTDAARRIYDETQGRQQVLPLDSIYKKTLPDWK,LHIHKLKMIELRWLFLGIWQVTWTVSPPLTLHVVSMMKPKVVSRCCPLILFTRRLFQIGK,CTSSTNRSCDGYFLASGKHGLCSHPNHRCTSYLNPRSSAGVAPFYLQEDSSRLEK

Amino Acids from 3' Exons

YLVCCETPLFWIIWMRPIIIEK,IWYAVRRHHYFGSGCGQSLKR,FGMLLGDTIILDNLDAANHYRKE