McDonnell Genome Institute

Washington University

CircRNA

chr18|2743760|2763789|+|SMCHD1|ENST00000320876.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9387

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

14

Peptide

TLEFPFVNGSAEIMENTQSISVR

Amino Acids from 5' Exons

ENTQSISVRGIKFIPGPPGNKDLCFTWREFSDFIRVQLISGPPAKLLLIDWPELKE,KTHRVVEASNLFQVLLEIRIFVLLGVSFLTLFECNFLDLLLNFSLTGQNR,KHTEYKCKRHQIYSRSSWKGSLFYLAVFLYSSATNFWTSCTSPYRLARTKG

Amino Acids from 3' Exons

DDYDNHTGIDLVGTIIATIKGSNEEDTDTPLFIGKVRTLEFPFVNGSAEIM,MTTTTILELIWLALPPLKALMRKILIPHFLLGKLEHLNSPSMVRLKS,LRQPYWNFGWHYNSHHRLGRYYPTFYWESNTIPLREWFGNH