McDonnell Genome Institute

Washington University

CircRNA

chr18|2738396|2740821|+|SMCHD1|ENST00000320876.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9679

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

4

Peptide

TTFQVNWTPEINK

Amino Acids from 5' Exons

VNWTPEINKEHLLQGLLPDVQVPTSVKDMRYCQVSFQDDHVSLESAFTV,LIGLLRLTKNTCYRVCFLMCKYQHLKICAIARFHSKMIMCLWKVRLQ,LDSDQRTLATGSASCASTNICKRYALLPGFIPRSCVFGKCVYSK

Amino Acids from 3' Exons

LLQISTEIRFKHFHQVLYLLCQLLGLDLIAQIKQPF,YNNYRSVRKSDSSIFTKFFIFFVNCWGWTLKFENNLS,IIITDQYGNQIQAFSPSSLSSLSIAGVGLDSSNLKTTFQ