top of page

McDonnell Genome Institute

Washington University

CircRNA

chr18|2700734|2705807|+|SMCHD1|ENST00000320876.10

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9826

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

YMLQEER

Amino Acids from 5' Exons

LLVYSSEERACTNMLQDIWCIIHQIPGQHKIDVYGSAKIEREHPFYKDFKWT,FDWCTPPKKRGLAPIECYNRISGALFTNDKFQVSTNKLTFMDLELKLKDKNTLFTRILNGQ,LTGVLLLRREGLHQLNATIGYLVHYSLMTNSRSAQINRLWILSNKIRTPFLQGFMD

Amino Acids from 3' Exons

VKTIKTLPLFYGSIVRFFLYGDHDGEVYATGGEVQIAM,SRQSRHFPSFMEADFFFMAIMMEKYMLQEERFKLQ,QDNQDTSPLLWKHSKIFSLWRSWRSICYRRRGSNCN

bottom of page