McDonnell Genome Institute

Washington University

CircRNA

chr18|24080584|24125550|+|TTC39C|ENST00000304621.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9299

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

MSQAYIK

Amino Acids from 5' Exons

LISKVGGSLGKPGRFTINAIWTSMPFRSCIRRSLKSPLLMLQMIITLWLKGCLRSLTDKVLLALDMAFFTFAYPWCPQTCSKSSTCWVFLETAYRGFLHCMQAKVRTRPLL,LYQRWVDPESLEDLQMLSGHQCPSGAVSEEANRVLDFCCKSHCGRGVGVSEQTERCCLWIWPFSPLHIHGAPKPAQNHQPAGFSWRPPTGAFFTDVCKRKGHEGPFSY,YIKGGWILRKAWKIYNKCYLDINALQELYQKKLTEESLTSDAANDNHIVAEGVSEESLNRLKGAVSFGYGLFHLCISMVPPNLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLA

Amino Acids from 3' Exons

AERFRKQTPTKALCVLASIEVLYLWKALPNCSFPNLQRMSQ,QSDFGSKPQPKRSVCWRLLKCCTCGKLFQTVPSPTCRGVK,RAISEANPNQSALCVGVYSVVLVESSSKLFLPQPAEDES