top of page

McDonnell Genome Institute

Washington University

CircRNA

chr18|23901126|23907935|+|LAMA3|ENST00000269217.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9411

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

8

Peptide

ALTDADNSVLNR

Amino Acids from 5' Exons

CTGGPGRKPTRGRTMGLLTVSGILMNTKPNSVTFVLGCRRQLPKPSRQMATKKTRELWEPF,AEPDKDLAENPPGGEQWACQYPGFFKIRSQTQPSCSAAGGSCPSQAGKWLEPRKRESFGSHS,LNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQ

Amino Acids from 3' Exons

VILMLSVVQRAWSERPTTSQMRFWMGSTPSRQMWKELRTPMGGHRTKTSKRLLMQITR,YCYDQCKEHGQKGQRHHRGSGWAQPHPDRCGKNGHLWEDTERRLQKGSDCRL,DIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGRTQNEDFKKALTDADNS

bottom of page