McDonnell Genome Institute

Washington University

CircRNA

chr18|23473428|23479424|+|RIOK3|ENST00000339486.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9719

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LSMEDEK

Amino Acids from 5' Exons

HGGKGRSYTYRMCHQGINNPIESQIYRFQVRSLQTKSTDHPHVGRKRNAQSRK,MEDEKEDSKVIPTECAIKVFKTTLNEFKNRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLA,WRMKRKIVKLYLQNVPSRYLKQPLMNLRIVTNILKMISGLKIASVNIHVRSSACGQKKKCTISQ

Amino Acids from 3' Exons

FFQKGGVKEALSERELFNAVSGLNITADNEADFLAE,FSRKEESRKPLVNENSSMLFQATSQQIMKLIFL,FPERRSQGSPTRTLQCCFRLKHHSRSFFS