McDonnell Genome Institute

Washington University

CircRNA

chr18|23473428|23477268|+|RIOK3|ENST00000339486.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9423

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

MSRSMEDEK

Amino Acids from 5' Exons

HGGKGRSYTYRMCHQGINNPIESQIYRFQVRSLQTKSTDHPHVGRKRNAQSRK,MEDEKEDSKVIPTECAIKVFKTTLNEFKNRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLA,WRMKRKIVKLYLQNVPSRYLKQPLMNLRIVTNILKMISGLKIASVNIHVRSSACGQKKKCTISQ

Amino Acids from 3' Exons

VWLIDVSQSVEPTHPHGLEFLFRDCRNVSQ,SGSMSVSQNLPTLTAWSSCSGTAGMSR,LVDRCQSVSRTYPPSRPGVLVPGLQECLA