McDonnell Genome Institute

Washington University

CircRNA

chr18|21846943|21858646|+|MIB1|ENST00000261537.6

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9309

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

EQLIMGLGTQGAEK

Amino Acids from 5' Exons

LIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPNLCKALAKCHKEKV,WDLVPRGQRRRVQHLLPVSWQPMVLTAFEIRRVNRHLISVLIRISAKHWQSVIRKKS,NNGTWYPGGREEECSIYCLFLGSQWCPEHSKEGSIATSLSSESLQSTGKVSGKSQ

Amino Acids from 3' Exons

QVGIFQYYKRTRIIPMSMQMCKSCSNSYKTLKS,KWEYSSITKGQGYQCQCRCAKVAATVTRHRA,SGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQ