McDonnell Genome Institute

Washington University

CircRNA

chr18|21006350|21020239|-|ROCK1|ENST00000399799.2

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9348

35

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

GHDSEMIGDLQAGK

Amino Acids from 5' Exons

LEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTDKDYYQLQAILEAERRDRGHDSEMIGDLQ,KKPMTYLGQNRTQLDGRVTQRASQLVSSPTESCKREIEFRILSHKQTKIITSCKLYKLNEETEVMILRLETFK,RRSQLTDRIGHSCKIEEESHRDEQVNSVRVPEQRVAREKSNFREFVTNRQRLLPAASYIRSTKRQRSFDDWRPS

Amino Acids from 3' Exons

QESLQKTIYKLEEQLHNEMQLKDEMEQKC,RKVCKKQSISWKNSCIMKCSKMKWSRSA,GKFAKNNLAGRTAANAVKRNGAEVQ