McDonnell Genome Institute

Washington University

CircRNA

chr18|20982762|20984535|-|ROCK1|ENST00000399799.2

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.932

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

RELQDQLEAEQYFSVK

Amino Acids from 5' Exons

TVRKRTDAGATRSASAIFL,QYRGNEGQMRELQDQLEAEQYFS,SIEEMKDRCGSYKISLKLSNIS

Amino Acids from 3' Exons

VKNLTLQLEQESNKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLT,LRIPCNWSRNQISGCCYKMNRLKHLRQTIKVKSRNRKILYWKQRDYNLSLSLR,ESNPATGAGIKAAVVTKIEDSSIGRQFKRFRKADETGNKYFIGSKEIIRIVSSAYE