McDonnell Genome Institute

Washington University

CircRNA

chr18|20968771|20970513|-|ROCK1|ENST00000399799.2

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9851

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

ISTLNEPLK

Amino Acids from 5' Exons

NINWRRRRRSVILRLPLKRISTLNEPLKH,ITGEGGGDQSGCLKEYQHTNPNT,YKLEKEEEISNLKAAFEKNINTERTLKTQ

Amino Acids from 3' Exons

RNSCYSVGSSRNKSVAVGARPSGRTVFIDARKQESCFKKTRDYRRSHCS,ETLATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSR,KLLLLSWIQKQKLSLSSWREAFWKNSILNRKKARKLLQEIDKRLQIKITLLV