McDonnell Genome Institute

Washington University

CircRNA

chr18|196636|199316|+|USP14|ENST00000261601.7

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9768

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

1

Peptide

LPLEICLIPWIK

Amino Acids from 5' Exons

PLEICLIPWIKLLPVFHLLFYCSFCTWLSHSLPRKVNKDSIFN,PRFVFHGNFFQYSTYYSTAVFAHGFPTVCRERTRTVSST,LRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQ

Amino Acids from 3' Exons

HEMYRIRRRSHQRKGKSTSALFYQSGSQVSFYRTI,MKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKL,NVQNLKKKKSPKERKINFSLAVLSIRKSSIFLQDLN