McDonnell Genome Institute

Washington University

CircRNA

chr17|9022310|9221242|+|NTN1|ENST00000173229.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.963

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

1

Peptide

APSAAGGQILGAAGPGQAGR

Amino Acids from 5' Exons

APSAAGGQILGAAGPGQAGRSMMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECV,RLLRQADRSSARQGRGKLDAACAQCGRRWRRWRRWRAWWARCAAGPGSACSRARRRSPIPARTRTATRAAASRTLSMRPSARTCACPAPAAGPRRATAWASAARSGCARATSATRPTPRRRTRPPSSPTSTTRTTRAGSPRTTCSSRTTSRSHCPSARSSKPTACSSARRGPSPWPSTSPWTTGARGCPSSSTPRSAARCTTGRTARPSPSRTSRRPCAPTRTPTCARSRAASSPSARWTGGPRRTTSTTRPCCRTGSRPQTSAWPSAACTRSATRTRTTRSWRATRTSTRCPTCRWAAGASATATRPAACATATTAWCATAGTTRPARSATAASPSTTTGPGSAPQPAKPTSAW,AFCGRRTDPRRGRAGASWTQHDARSVGGAGGAGGGGVPGGRGARRARAQHVRGPGGAARSLLGRERPPAPLHPGLCQCGLRQGRARVQHLRPAPGALLRGERARRGAAALVPPLQRVRPQEGAPARLPHRPQQPAQPDVLAVRELPAVPAQRHAHTVPRQEVRSDLREPAVLLAAARVHGHLQVHGLRAHVGALPVLLHAVPQDVQPAAPRAHHQAERAGGRVHRLAHRHAPALGRPHRLQHAGRAALGARLRQLARAAGLGHGHRHPRGLQPPAHVRRRERGRLGAGARLVLLRGVRPAGGRPVQVQRPRGPLRARPRRQPGVRLQAQHGRPGVRPLQALPLRPALAARHSPRSQRVR

Amino Acids from 3' Exons

TAIPTARPPRGSRLTKSTARRTM,LRFLLQGLQGEAEDHEKVLQEGL,CDSYCKASKGKLKINMKKYCKKDY