McDonnell Genome Institute

Washington University

CircRNA

chr17|8512450|8535931|-|MYH10|ENST00000269243.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9968

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

18

Peptide

KMQAHIQANPPGVLALLDEECWFPK

Amino Acids from 5' Exons

LLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQ,FKRRISLQNNYKQRLSSLLKQKRGQDLLLKSRNKRFYMTWSLGLKKKKKETKSSKMKRKKCKHIF,FRREEYPCRTTTSRDALCSRRDEGKTCCKAGIRRDSTLGVGRRRRKKPNPPKKEKNASTYS

Amino Acids from 3' Exons

ANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGK,RTLLVYWPFWMKNAGSLKPQIKPLLKNWFKSKVPTPSFRNLDNKTKLIFALYIMQG,EPSWCTGPFGRMLVPSHRNLCKTGSRARFPLQVSETSTIKRQSFLHYTLCRE