McDonnell Genome Institute

Washington University

CircRNA

chr17|8504693|8535931|-|MYH10|ENST00000269243.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.994

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

2

Peptide

TELEDTLDTTAAQQELRR

Amino Acids from 5' Exons

RNTPEQCPSCARATSPNCTSGRLIREGFTEQGRKAEKGLEGTGSSENRAGGHAGHHGSPAGTT,GDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQEL,VMMKHSIRTMPLKLCESYKPKLLNFRKTLNPRRLHGTRPKSRKGTVRNWKLKQSWRTRWTPRQPSRNY

Amino Acids from 3' Exons

ANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGK,RTLLVYWPFWMKNAGSLKPQIKPLLKNWFKSKVPTPSFRNLDNKTKLIFALYIMQG,EPSWCTGPFGRMLVPSHRNLCKTGSRARFPLQVSETSTIKRQSFLHYTLCRE