McDonnell Genome Institute

Washington University

CircRNA

chr17|8493732|8495241|-|MYH10|ENST00000269243.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9517

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

16

Peptide

QVLALQSQNELDNVSTLLEEAEKK

Amino Acids from 5' Exons

ELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQ,SFFRRRHARNTAVGSGSWKRRRTVFRSSRRRRRRPGRTWRSKCWPCSP,ASSGGDTPETKPEQSDPAAGRGEEQSSGAAGGGGGGQEEPGEASAGPAVP

Amino Acids from 3' Exons

NELDNVSTLLEEAEKKGIKFAKDAASLESQLQDTQ,MSIMSPPFWKKQRRRVLNLLRMQLVLSLNYRIH,ARCLHPSGRSREEGYICGCSSVSTTGYT