McDonnell Genome Institute

Washington University

CircRNA

chr17|8480109|8493024|-|MYH10|ENST00000269243.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9685

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

5

Peptide

IGQLEEQLEQEANWLIPR

Amino Acids from 5' Exons

VDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQLEQEA,WTHTPSQPSAAPPRRVTMHASNWSGRTRSRPSCRNSRVLSSLSSRPPSQPWRPRLGSWRSSLSRKP,GHTERRASSRAQRRPEEQCTPATGAAEQGAEGQAAGTRGCCQVVQGHHLSPGGQDWAAGGAAAGSQ

Amino Acids from 3' Exons

LADTKKKVDDDLGTIESLEEAKKKLLKDAEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFDQ,WLIPRRKMTTWEQLKVWKKPRRSFRTRRPASAWRRRHWRMTNWRRPRTACSRSWTTSRWTWTTSARSPPTWRRSRRSLT,GYQEESRRPGNNKSGRSQEEASEGRGGPEPAPGGEGTGVQTGEDQEPPAAGAGRPHGGPGPPAPGRLQLGEEAEEVP