McDonnell Genome Institute

Washington University

CircRNA

chr17|8255804|8256648|+|PFAS|ENST00000580356.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.935

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

GGEAPGPGWVSVGPR

Amino Acids from 5' Exons

VWLTLGTTSTPSASRSYSGTRALWRPLTWRSPI,SGFRLLGPRLLHQALPGATAEPEHCGGLLGAVQ,LALDSWDLDFYTKRFQELQRNPSTVEAFDLAQSN

Amino Acids from 3' Exons

RAQPTLVLQGPAPRGWAEAGALTVVHHEHPGILEPQQRPQILQQVLCPRLGWRQDPGRGGPRPWLGCRSQKGSKVHDGYVHSAIQGKEVRFLRPEDPTRPSRFQQQQGLRHVVFTAETHNFPT,EHSRHWFFKGQLHVDGQKLVHSLFESIMSTQESSNPNNVLKFCDNSRCCALDWVGVRTRGGEAPGPGWVSVGPRKEARSMTGMSTVQSRERKSDSYGLRTPHGQAASSNSKGDMLSSQQRLTTFPQ,STADTGSSRASSTWMGRSWCTHCLSPSAPRNPRTPTTSSNSVITAGAVPTGLASGPGEGRPQALVGLVVPERKQGPRVCPQCNPGKGSPIPTAGPHTAKPLPATARAETCCLHSRDSQLSH